update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net - URL scan, 22 Aug 2026

MalwareAnalyzer by Cyble scanned update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net and returned a unknown verdict (score -4). The page resolved to 81.169.242.140 on Strato Rechenzentrum, Berlin in DE. The domain was registered 7190 days ago through Cronon GmbH. 1 domain and 1 IP were contacted, over 37 HTTP requests. This is a point-in-time observation from 22 Aug 2026; the page may have changed since.

Scan result

Antivirus & YARA (0 of 48 engines)

No engine flagged this page's content.

Why this verdict

Contacted infrastructure

Observed indicators

Questions about update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net

Is update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net safe?
The scan of update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net on 22 Aug 2026 reached no verdict either way (score -4). Too little was captured to judge it, which is an unknown rather than a pass.
How was update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net checked?
A static pass resolved DNS, captured TLS and headers and followed the redirect chain, and where the standard tier allows, a headless browser rendered the page and recorded every request. Egress is SSRF-locked. Signatures that matched only page text are weighted far below one that matched a served file, because a page documenting malware matches the same rules.

Scanned at the standard tier - see how URL scanning works.

Scan another URL · Latest analyzed threats · All scans of update.qtupdate.update.adcbupdate.update.onmtsnmlgfepkfahgfedwwwwwwchasenrainbowsbigisland.comw.h2977615.stratoserver.net

Scanned on MalwareAnalyzer by Cyble · Open interactive scan